PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc02204.1.g00080.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 390aa    MW: 43045.6 Da    PI: 9.3606
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc02204.1.g00080.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.41.1e-17278332256
                                   T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                      Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                   rk+ ++t+ q   Le+ F+ ++ +s++++ +LA+++gL+ rqV vWFqNrRa+ k
  Zpz_sc02204.1.g00080.1.am.mk 278 RKKLRLTSAQASLLEDSFRAHNILSHAQKHDLARRVGLSARQVEVWFQNRRARTK 332
                                   788899***********************************************98 PP

2HD-ZIP_I/II108.93.6e-35278365188
                   HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLe 81 
                                   +kk+rl++ q++lLE+sF++++ L++ +K++lar++gl++rqv+vWFqnrRARtk+kq+E+d+e L+r++d+l++en+rL+
  Zpz_sc02204.1.g00080.1.am.mk 278 RKKLRLTSAQASLLEDSFRAHNILSHAQKHDLARRVGLSARQVEVWFQNRRARTKLKQTEVDCELLRRWCDSLTDENARLR 358
                                   69******************************************************************************* PP

                   HD-ZIP_I/II  82 keveeLr 88 
                                   ++ +e r
  Zpz_sc02204.1.g00080.1.am.mk 359 RDLAERR 365
                                   *988765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.811274334IPR001356Homeobox domain
SMARTSM003891.1E-13276338IPR001356Homeobox domain
SuperFamilySSF466893.76E-17276343IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.8E-17278337IPR009057Homeodomain-like
PfamPF000464.0E-15278332IPR001356Homeobox domain
CDDcd000862.16E-12278335No hitNo description
PRINTSPR000314.9E-5305314IPR000047Helix-turn-helix motif
PROSITE patternPS000270309332IPR017970Homeobox, conserved site
PRINTSPR000314.9E-5314330IPR000047Helix-turn-helix motif
SMARTSM003406.0E-14334377IPR003106Leucine zipper, homeobox-associated
PfamPF021839.8E-7334361IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 390 aa     Download sequence    Send to blast
MTMKKCPCEK RGPGAQEEQV YYSYVVAEPQ PCVNRLIPVY TCSTLHARQV SGGSIALEKK  60
KPLFHTYGSR SWKQPRSDDP YLPTPHTRTG LPRARAACLF SQHEQEQLAW SLDQEATEET  120
DPCSHLIVLA NPGTKPRDRV RPSAFPSTLL LIGTSQPAPA HPVHQQSTSL TTAGSSMEDC  180
SAEYDTRLAL ETSRPLPPQG HATVRLFGEL ISPQDHGRGR ADRLEPTAPA VGRKKRADCG  240
GVETATGGAG GRQNKRAIRT LQVEDDGDRR SQSDGGSRKK LRLTSAQASL LEDSFRAHNI  300
LSHAQKHDLA RRVGLSARQV EVWFQNRRAR TKLKQTEVDC ELLRRWCDSL TDENARLRRD  360
LAERRAAAAV SVVCPSCCNK KMAVVAGDMA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1276282SRKKLRL
2326334RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004951890.12e-67PREDICTED: putative homeobox-leucine zipper protein HOX26
SwissprotQ67UX63e-46HOX26_ORYSJ; Putative homeobox-leucine zipper protein HOX26
TrEMBLK3YVK92e-67K3YVK9_SETIT; Uncharacterized protein
STRINGSi018305m7e-67(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP83153249
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.12e-28HD-ZIP family protein